PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G276100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 369aa    MW: 40264.1 Da    PI: 4.189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G276100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.91.7e-1871345128
                 NAM   5 frFhPtdeelvveyLkkkvegkkleleev.ikevdiy.kvePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +rF+ t  e v ++L + ++g++l+ +e  i+++diy ++eP+dL +    + ka+++   +fF+ +++++ + +r+ r++ +g+W  + k
  Brast05G276100.1.p   7 CRFDLTPLEAVAYFLPRLLSGETLHGAERfIHRADIYgNLEPKDLAAafppANKADRTgARFFFTLSKRQKGSRSRSARSAGAGTWTIQ-K 96 
                         6999999****************7765555******9456*****8446653334444366*************************965.7 PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + ++ ++ g +vg  k L f +++++  e++ Wvm+eyr 
  Brast05G276100.1.p  97 TIDINDEAGVKVGEEKKLSFKSKKDK--ESSGWVMEEYRC 134
                         799***9*************955555..59********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100519.5423154IPR003441NAC domain
PfamPF023655.0E-107133IPR003441NAC domain
SuperFamilySSF1019411.07E-178153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEVFALCRFD LTPLEAVAYF LPRLLSGETL HGAERFIHRA DIYGNLEPKD LAAAFPPANK  60
ADRTGARFFF TLSKRQKGSR SRSARSAGAG TWTIQKTIDI NDEAGVKVGE EKKLSFKSKK  120
DKESSGWVME EYRCLLPEAV VEDGEMVLCK IHLSHSACSK KARQRSAARR LSGSQEQEGH  180
TAPMPEVTAK RPAPAASDDH DPPCAKRSRV DDAQDEAAVE AADNMMDGRF SCTMEELLGG  240
AATDEEQQDA TLLPAVEAEQ QMVDFDFNFD DLPVLDDDVL GEIMLSLDDE APMSLPALDD  300
GDLVSLPAVE AEQLRGVDLP IASDEGFDFE LPTDEELDAM ISQLQENWPV SFVPDGDLVS  360
FPGLPAVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239527.11e-167PREDICTED: uncharacterized protein LOC104585199
TrEMBLA0A0Q3HVP81e-168A0A0Q3HVP8_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI4G43020.11e-167(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18322799